mCherry

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Aug 18, 2022 12:38:12. Or view the full change history

190

mCherry is a basic (constitutively fluorescent) red fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Discosoma sp.	26.7 kDa	-

FPbase ID: ZERB6

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
587	610	72,000	0.22	15.84	4.5	15.0	1.4

Edit States/Attributes

mCherry OSER Measurements

% Normal Cells	OSER/NE ratio	Cell Type	Reference
69.0 (1130 cells)	-	U-2 OS	Manna et al. (2018)
80.0 (369 cells)	2.0 ± 0.3 (38 cells)	U-2 OS	Bindels et al. (2016)
91.0 (98 cells)	-	HeLa	Costantini et al. (2015)
95.0 ± 0.8 (10000 cells)	-	HeLa	Cranfill et al. (2016)

Photostability

t_1/2 (s)	Power	Light	Mode	In Cell	Fusion	˚C	Reference
68.0							Shu et al. (2006)

A caution on interpretation of photostability measurements

Add photostability info

mCherry Sequence

BLAST

mCherry was derived from mRFP1.5 with the following mutations: N8D/K199N/T200V/D201NN6D/K194N/T195V/D196N
amino acid numbers relative to mRFP1.5DsRed. show relative to DsRed show relative to mRFP1.5

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

GenBank: AAV52164

UniProtKB: X5DSL3

IPG: 3838123

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

Randomization of position 163 in mRFP1.4 led to the identification of the substitution M163Q, which results in a nearly complete disappearance of the absorbance peak at ∼510 nm, present in all previous mRFP clones.

Shaner et al. (2004)

To test whether the introduction of GFP-type termini into mRFP variants would benefit fusion proteins expressed in mammalian cells, we fused mRFP1 and mCherry to the N terminus of α-tubulin. In most HeLa cells, expression of mRFP1-α-tubulin resulted in diffuse cytoplasmic fluorescence rather than proper incorporation into microtubules. However, mCherry-α-tubulin fusions were successfully incorporated into microtubules in most cells, similar to results seen with GFP-coupled tubulin.

Shaner et al. (2004)

This strongly suggests that the fluorescent protein tag caused clustering artifacts (Fig. 2a) and that ClpX and ClpP fluorescent protein fusions cannot be trusted for determining localization of native, untagged proteins. [...] These findings motivated us to evaluate other fluorescent proteins fused to ClpP or ClpX. We found that sfGFP, Venus, mCherry and mCherry2 all caused substantial foci formation, despite being monomers or very weak dimers when expressed alone. mKate2 and TagRFP-T caused intermediate clustering, whereas with mVenus and mYPet most of the fluorescence signal was spatially uniform, although we observed foci in a few cells. mTagBFP and mEos2 fusions resulted in a weak signal with infrequent dim foci. We detected no foci for photoswitchable (PS)-CFP2, reversible switchable (rs)FastLime (data not shown) and a mutant of sfGFP with a charge of −30 (GFP(−30)), but the signals were very dim. Finally, mGFPmut3, Dronpa and Dendra2 displayed an essentially uniform signal. Fluorescent protein fusions to ClpP generally caused more foci formation than fusions to ClpX, in particular for mYPet (Fig. 2d).

Landgraf et al. (2012)

In mCherry, the direction of the transition dipole moment (the 'molecular antenna') is -8° from the line connecting the centers of the aromatic rings.

Myšková et al. (2020)