compare

Comparison List

TagRFP-T

TagRFP-T is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It is reported to be a very slowly-maturing monomer with low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
555 584 81,000 0.41 33.21 4.6 100.0 2.3

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
41.2 ± 4.0 (10000 cells) - HeLa Cranfill et al. (2016)
43.0 (740 cells) - U-2 OS Manna et al. (2018)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
337.0 Bindels et al. (2016)

TagRFP-T Sequence

TagRFP-T was derived from TagRFP with the following mutations: S2_S2delinsVSKGE/S158T/H230_K231insKLNGMDELY

Note: While the only significant mutation in TagRFP-T relative to the parental TagRFP is S158T, here we show the version with the addition of the EGFP N- and C- termini that is by far the most variant (e.g. on Addgene and SnapGene)

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRTDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: ACD03281

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for TagRFP-T
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change