compare

Comparison List

TagRFP-T

TagRFP-T is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.6 kDa -

FPbase ID: LF3LJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
555 584 81,000 0.41 33.21 4.6 100.0 2.3
Edit States/Attributes

TagRFP-T OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
41.2 ± 4.0 (10000 cells) - HeLa Cranfill et al. (2016)
43.0 (740 cells) - U-2 OS Manna et al. (2018)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
337.0   Bindels et al. (2016)
A caution on interpretation of photostability measurements
Add photostability info

TagRFP-T Sequence

TagRFP-T was derived from TagRFP with the following mutations: S2_S2delinsVSKGE/S158T/H230_K231insKLNGMDELY

Note: While the only significant mutation in TagRFP-T relative to the parental TagRFP is S158T, here we show the version with the addition of the EGFP N- and C- termini that is by far the most variant (e.g. on Addgene and SnapGene)

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRTDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: ACD03281

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for TagRFP-T
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving the photostability of bright monomeric orange and red fluorescent proteins

Shaner Nc, Lin Mz, Mckeown Mr, Steinbach Pa, Hazelwood Kl, Davidson Mw, Tsien Ry

(2008). Nature Methods, 5(6) , 545-551. doi: 10.1038/nmeth.1209. Article   Pubmed

Additional References

  1. mScarlet: a bright monomeric red fluorescent protein for cellular imaging

    Bindels Ds, Haarbosch L, Van Weeren L, Postma M, Wiese Ke, Mastop M, Aumonier S, Gotthard G, Royant A, Hink Ma, Gadella Twj

    (2016). Nature Methods, 14(1) , 53-56. doi: 10.1038/nmeth.4074. Article   Pubmed

  2. Comparative assessment of fluorescent proteins for in vivo imaging in an animal model system

    Heppert Jk, Dickinson Dj, Pani Am, Higgins Cd, Steward A, Ahringer J, Kuhn Jr, Goldstein B

    (2016). Molecular Biology of the Cell, 27(22) , 3385-3394. doi: 10.1091/mbc.e16-01-0063. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change