compare

Comparison List

mRFP1.5

mRFP1.5 is a fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: MO63Q

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mRFP1.5 Sequence

mRFP1.5 was derived from mRFP1.4 with the following mutations: R17H/M163Q
amino acid numbers relative to DsRed. show relative to mRFP1.4

MVSKGEENNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mRFP1.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change