compare

Comparison List

mEos2

mEos2 is a photoconvertible green/yellow fluorescent protein published in 2009, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Lobophyllia hemprichii 25.8 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 573 584 46,000 0.66 30.36 6.4    
Green 506 519 56,000 0.84 47.04 5.6    

Transitions

From To Switch λ
Green Red 405

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
11.0 ± 6.2 (10000 cells) - HeLa Paez-Segala et al. (2015)

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
Red 323.0 475.0 (mW/cm2) Arc-lamp Widefield H2B McKinney et al. (2009)
Red 2700.0 100.0 (µW) Laser Point Scanning Confocal H2B McKinney et al. (2009)
Red 48.0 64.0 (µW) Laser Point Scanning Confocal H2B Zhang et al. (2012)
Green 42.0 175.0 (mW/cm2) Arc-lamp Widefield H2B McKinney et al. (2009)
Green 240.0 100.0 (µW) Laser Point Scanning Confocal H2B McKinney et al. (2009)
Green 14.0 24.0 (µW) Laser Point Scanning Confocal H2B Zhang et al. (2012)

mEos2 Sequence

mEos2 was derived from mEos with the following mutations: N11K/E70K/H74N/H121Y

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

mEos2 forms oligomers at high concentrations and forms aggregates when labeling membrane proteins

Zhang et al. (2012)

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change