compare

Comparison List

Dronpa

a.k.a. 22Gm3

Dronpa is a photoswitchable green fluorescent protein published in 2004, derived from Echinophyllia sp. SC22.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.5 kDa -

FPbase ID: 7P38V

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 503 518 95,000 0.85 80.75     3.6

Transitions

From To Switch λ
Off On 400
On Off 503

Photostability

No photostability measurements available ... add one!

Dronpa Sequence

Dronpa was derived from 22G with the following mutations: I102N/F114Y/L162S/R194H/N205S/G218E

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK
GenBank: BAD72874
IPG: 3892390

Structure

Deposited: ,
Chromophore:

Excerpts

Based on the capacity of its fluorescence to vanish and reappear, 22Gm3 was renamed “Dronpa,” after “dron,” a ninja term for vanishing, and “pa,” which stands for photoactivation.

Ando (2004)

We found 22Gm3 to possess a distinctive photosensitivity. Strong excitation at around 490 nm appeared to bleach 22Gm3 more efficiently than other fluorescent proteins, and the bleached protein regained its green fluorescence completely with minimal irradiation at around 400 nm. We intermittently measured the absorbance of a solution containing 22Gm3 at pH 7.4 in a cuvette during continuous illumination at 490 ± 10 nm with a 75-W xenon lamp. After a 40-min incubation, nearly all the protein molecules had been converted into the neutral, nonfluorescent state. Illumination at 400 ± 7.5 nm for several minutes reversed the protein to its original fluorescent state. Thus, 22Gm3 has photochromic behavior, because its fluorescence can be switched on and off by using two different wavelengths of light.

Ando (2004)

Primary Reference

Regulated Fast Nucleocytoplasmic Shuttling Observed by Reversible Protein Highlighting

Ando R

(2004). Science, 306(5700) , 1370-1373. doi: 10.1126/science.1102506. Article   Pubmed

Additional References

  1. Structural characterization of the photoswitchable fluorescent protein Dronpa-C62S

    Nam K-H, Kwon Oy, Sugiyama K, Lee W-H, Kim Yk, Song Hk, Kim Ee, Park S-Y, Jeon H, Hwang Ky

    (2007). Biochemical and Biophysical Research Communications, 354(4) , 962-967. doi: 10.1016/j.bbrc.2007.01.086. Article   Pubmed

  2. From The Cover: Reversible single-molecule photoswitching in the GFP-like fluorescent protein Dronpa

    Habuchi S, Ando R, Dedecker P, Verheijen W, Mizuno H, Miyawaki A, Hofkens J

    (2005). Proceedings of the National Academy of Sciences, 102(27) , 9511-9516. doi: 10.1073/pnas.0500489102. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change