compare

Comparison List

mKate2

mKate2 is a basic (constitutively fluorescent) red fluorescent protein published in 2009, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.1 kDa -

FPbase ID: DBBO8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 633 62,500 0.4 25.0 5.4 20.0 2.5

mKate2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
81.1 ± 6.1 (10000 cells) - HeLa Cranfill et al. (2016)
59.0 (102 cells) 3.6 ± 0.8 (42 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
84.0   Bindels et al. (2016)

mKate2 Sequence

mKate2 was derived from mKate with the following mutations: M1_S2insV/V45A/M146T/S158A/K231R

MVSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKAVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTETLYPADGGLEGRADMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHR

Excerpts

No excerpts have been added for mKate2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change