compare

Comparison List

mRFP1.4

mRFP1.4 is a fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

mRFP1.4 Sequence

mRFP1.4 was derived from mRFP1.3 with the following mutations: V7I/M182K
amino acid numbers relative to DsRed. show relative to mRFP1.3

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

Through additional rounds of screening random libraries based on mRFP1.3 and wavelength-shifted mRFP variants, we identified the beneficial folding mutations V7I and M182K, which were incorporated into clone mRFP1.4.

Shaner et al. (2004)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change