compare

Comparison List

Superfolder GFP

a.k.a. sfGFP

Superfolder GFP is a basic (constitutively fluorescent) green fluorescent protein published in 2005, derived from Aequorea victoria. It is reported to be a very rapidly-maturing weak dimer.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: B4SOW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 510 83,300 0.65 54.15   13.6 3.1
Edit States/Attributes

Superfolder GFP OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
62.4 ± 6.3 (10000 cells) - HeLa Cranfill et al. (2016)
- 2.2 ± 0.1 (74 cells) U-2 OS Costantini et al. (2012)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
208.26 80.0 (uW) Laser   idk Cranfill et al. (2016)
11.0 29.0 (W/cm2) Laser Other 25.0 Ivorra-Molla et al. (2023)
A caution on interpretation of photostability measurements
Add photostability info

Superfolder GFP Sequence

BLAST

Superfolder GFP was derived from Folding Reporter GFP with the following mutations: S30R/Y39N/N105T/Y145F/I171V/A206V

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: ASL68970
IPG: 154375264

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Superfolder GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering and characterization of a superfolder green fluorescent protein

Pédelacq J-D, Cabantous S, Tran T, Terwilliger Tc, Waldo Gs

(2005). Nature Biotechnology, 24(1) , 79-88. doi: 10.1038/nbt1172. Article   Pubmed

Additional References

  1. Site-Specific Fragmentation of Green Fluorescent Protein Induced by Blue Light

    Heckmeier Pj, Langosch D

    (2021). Biochemistry, 60(32) , 2457-2462. doi: 10.1021/acs.biochem.1c00248. Article   Pubmed

  2. I see the light! Fluorescent proteins suitable for cell wall/apoplast targeting in Nicotiana benthamiana leaves

    Stoddard A, Rolland V

    (2019). Plant Direct, 3(1) , e00112. doi: 10.1002/pld3.112. Article   Pubmed

  3. A Novel Ultra-Stable, Monomeric Green Fluorescent Protein For Direct Volumetric Imaging of Whole Organs Using CLARITY

    Scott Dj, Gunn Nj, Yong Kj, Wimmer Vc, Veldhuis Na, Challis Lm, Haidar M, Petrou S, Bathgate Rad, Griffin Mdw

    (2018). Scientific Reports, 8(1) , 667. doi: 10.1038/s41598-017-18045-y. Article   Pubmed

  4. Systematic characterization of maturation time of fluorescent proteins in living cells

    Balleza E, Kim Jm, Cluzel P

    (2017). Nature Methods, 15(1) , 47-51. doi: 10.1038/nmeth.4509. Article   Pubmed

  5. Different Photochemical Events of a Genetically Encoded Phenyl Azide Define and Modulate GFP Fluorescence

    Reddington Sc, Rizkallah Pj, Watson Pd, Pearson R, Tippmann Em, Jones Dd

    (2013). Angewandte Chemie International Edition, 52(23) , 5974-5977. doi: 10.1002/anie.201301490. Article   Pubmed

  6. Synthetic Biology of Proteins: Tuning GFPs Folding and Stability with Fluoroproline

    Steiner T, Hess P, Bae Jh, Wiltschi B, Moroder L, Budisa N

    (2008). PLoS ONE, 3(2) , e1680. doi: 10.1371/journal.pone.0001680. Article   Pubmed

  7. A Comparison of the Fluorescence Dynamics of Single Molecules of a Green Fluorescent Protein: One- versus Two-Photon Excitation

    Cotlet M, Goodwin Pm, Waldo Gs, Werner Jh

    (2006). ChemPhysChem, 7(1) , 250-260. doi: 10.1002/cphc.200500247. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change