compare

Comparison List

TagBFP

a.k.a. mTagBFP

TagBFP is a basic (constitutively fluorescent) blue fluorescent protein published in 2008, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing monomer with very low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.3 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
402 457 52,000 0.63 32.76 2.7 13.0 2.6

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
56.5 (69 cells) - HeLa Costantini et al. (2015)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
34.0 Subach et al. (2008)

TagBFP Sequence

TagBFP was derived from TagRFP with the following mutations: N20D/M63L/R67K/P127T/N143F/M146T/S158N/G168S/C172A/F174I/H197Y/D206N/K207N/*230LextN
amino acid numbers relative to eqFP578. show relative to TagRFP

Note: Subach et al (2008), derives mTagBFP from TagRFP, but Fig 1 depicts TagRFP (and therefore mTagBFP) with two glutamic acids in the N terminus instead of one, as shown in the original TagRFP paper (Merzlyak et al 2007). At Snapgene and in the vast majority of variants seen on Addgene, there is only a single glutamic acid. Here, we use a single glutamic acid in the N terminus, in contrast to the original paper.

MSELIKENMHMKLYMEGTVDNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFLYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEAFTETLYPADGGLEGRNDMALKLVGGSHLIANIKTTYRSKKPAKNLKMPGVYYVDYRLERIKEANNETYVEQHEVAVARYCDLPSKLGHKLN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for TagBFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change