compare

Comparison List

Venus

a.k.a. SEYFP-F46L

similar: mVenus

Venus is a basic (constitutively fluorescent) yellow fluorescent protein published in 2002, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: YUJWJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 528 92,200 0.57 52.55 6.0 17.6 3.0
Edit States/Attributes

Venus OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
36.5 ± 3.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
15.0   Kremers et al. (2006)
A caution on interpretation of photostability measurements
Add photostability info

Venus Sequence

BLAST

Venus was derived from SEYFP with the following mutations: F46L
amino acid numbers relative to avGFP. show relative to SEYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

F46L accelerates the oxidation step, leading to the enhancement of fluorescence development of YFP at 37°C. The SEYFP-F46L variant folds and forms the chromophore very efficiently at 37°C.

Nagai et al. (2002)

Primary Reference

A variant of yellow fluorescent protein with fast and efficient maturation for cell-biological applications

Nagai T, Ibata K, Park Es, Kubota M, Mikoshiba K, Miyawaki A

(2002). Nature Biotechnology, 20(1) , 87-90. doi: 10.1038/nbt0102-87. Article   Pubmed

Additional References

  1. Systematic characterization of maturation time of fluorescent proteins in living cells

    Balleza E, Kim Jm, Cluzel P

    (2017). Nature Methods, 15(1) , 47-51. doi: 10.1038/nmeth.4509. Article   Pubmed

  2. Cyan and Yellow Super Fluorescent Proteins with Improved Brightness, Protein Folding, and FRET Förster Radius†,‡

    Kremers G-J, Goedhart J, Van Munster Eb, Gadella Twj

    (2006). Biochemistry, 45(21) , 6570-6580. doi: 10.1021/bi0516273. Article   Pubmed

  3. Crystal Structure of Venus, a Yellow Fluorescent Protein with Improved Maturation and Reduced Environmental Sensitivity

    Rekas A, Alattia J-R, Nagai T, Miyawaki A, Ikura M

    (2002). Journal of Biological Chemistry, 277(52) , 50573-50578. doi: 10.1074/jbc.m209524200. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change