compare

Comparison List

Venus

a.k.a. SEYFP-F46L

similar: mVenus

Venus is a basic (constitutively fluorescent) yellow fluorescent protein published in 2002, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 528 92,200 0.57 52.55 6.0   3.0

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
36.5 ± 3.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
15.0 Kremers et al. (2006)

Venus Sequence

Venus was derived from SEYFP with the following mutations: F46L
amino acid numbers relative to avGFP. show relative to SEYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

F46L accelerates the oxidation step, leading to the enhancement of fluorescence development of YFP at 37°C. The SEYFP-F46L variant folds and forms the chromophore very efficiently at 37°C.

Nagai et al. (2002)

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change