compare

Comparison List

Dendra2

Dendra2 is a photoconvertible green fluorescent protein published in 2006, derived from Dendronephthya sp.. It has high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 490 507 45,000 0.5 22.5 6.6    
Red 553 573 35,000 0.55 19.25 6.9    

Transitions

From To Switch λ
Green Red 480

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
Green 30.0 4.4 (mW/cm2) Arc-lamp Widefield Kaberniuk et al. (2017)
Red 1050.0 4.4 (mw/cm2) Arc-lamp Widefield Kaberniuk et al. (2017)

Dendra2 Sequence

Dendra2 was derived from Dendra with the following mutations: M1_N2insNTPGI/A224V

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVW

Structure

Deposited: ,
Chromophore:

Excerpts

PS-CFP2 can be effectively photoactivated by UV-laser line only. Dendra2, on the other hand, can be photoactivated using either violet or blue light, through either arc lamp or laser light irradiation.

Chudakov et al. (2007)

PS-CFP2 can be used in combination with red or far-red fluorescent protein for dual color labeling. Dendra2 cannot be combined with green or red fluorescent proteins, since it occupies both green and red channels. It cannot be combined with blue fluorescent proteins either, since they require violet light excitation, which causes photoactivation of Dendra2.

Chudakov et al. (2007)

Primary Reference

Additional References

  1. moxDendra2: an inert photoswitchable protein for oxidizing environments

    Kaberniuk Aa, Morano Nc, Verkhusha Vv, Snapp El

    (2017). Chemical Communications, 53(13) , 2106-2109. doi: 10.1039/c6cc09997a. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change