compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mGFPmut3

mGFPmut3 is a basic (constitutively fluorescent) green fluorescent protein published in 2017, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.9 kDa	-

FPbase ID: 37ZRR

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
500	513	89,400	0.39	34.87		4.1

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mGFPmut3 Sequence

BLAST

mGFPmut3 was derived from GFPmut3 with the following mutations: A206KA206K

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for mGFPmut3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Systematic characterization of maturation time of fluorescent proteins in living cells

Balleza E, Kim Jm, Cluzel P

(2017). Nature Methods, 15(1) , 47-51. doi: 10.1038/nmeth.4509. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for mGFPmut3
Search RIKEN BRC for mGFPmut3

Change history

Something missing or incorrect? Submit a change Submit a change