compare

Comparison List

mRuby3

mRuby3 is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
558 592 128,000 0.45 57.6 4.8    

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
14.0 (70 cells) - U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
349.0 Bajar et al. (2016)

mRuby3 Sequence

mRuby3 was derived from mRuby2 with the following mutations: N33R/M36E/T38V/K74A/G75D/M105T/C114E/H118N/Q120K/H159D/M160I/S171H/S173N/I192V/L202I/M209T/F210Y/H216V/F221Y/A222S/G223N
amino acid numbers relative to eqFP611. show relative to mRuby2

MVSKGEELIKENMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFMYGSRTFIKYPADIPDFFKQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGELVYNVKVRGVNFPSNGPVMQKKTKGWEPNTEMMYPADGGLRGYTDIALKVDGGGHLHCNFVTTYRSKKTVGNIKMPGVHAVDHRLERIEESDNETYVVQREVAVAKYSNLGGGMDELYK
GenBank: ATE88097

Excerpts

No excerpts have been added for mRuby3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change