compare

Comparison List

mRuby2

mRuby2 is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Entacmaea quadricolor. It is reported to be a very slowly-maturing monomer with moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.5 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
559 600 113,000 0.38 42.94 5.3 150.0 2.5
Edit States/Attributes

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
87.4 ± 5.8 (10000 cells) - HeLa Cranfill et al. (2016)
33.3 (60 cells) - HeLa Costantini et al. (2015)
14.0 (113 cells) - U-2 OS Bindels et al. (2016)
87.4 ± 5.8 (10000 cells) - HeLa Shaner et al. (2013)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
123.0 Bindels et al. (2016)
A caution on interpretation of photostability measurements
Add photostability info

mRuby2 Sequence

mRuby2 was derived from mRuby with the following mutations: N2_S3delinsVSKGEE/L15M/I102V/A119V/A131P/*230MextDELYK
amino acid numbers relative to eqFP611. show relative to mRuby

MVSKGEELIKENMRMKVVMEGSVNGHQFKCTGEGEGNPYMGTQTMRIKVIEGGPLPFAFDILATSFMYGSRTFIKYPKGIPDFFKQSFPEGFTWERVTRYEDGGVVTVMQDTSLEDGCLVYHVQVRGVNFPSNGPVMQKKTKGWEPNTEMMYPADGGLRGYTHMALKVDGGGHLSCSFVTTYRSKKTVGNIKMPGIHAVDHRLERLEESDNEMFVVQREHAVAKFAGLGGGMDELYK
GenBank: AFR60232
IPG: 30275455

Excerpts

No excerpts have been added for mRuby2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving FRET dynamic range with bright green and red fluorescent proteins

Lam Aj, St-Pierre F, Gong Y, Marshall Jd, Cranfill Pj, Baird Ma, Mckeown Mr, Wiedenmann J, Davidson Mw, Schnitzer Mj, Tsien Ry, Lin Mz

(2012). Nature Methods, 9(10) , 1005-1012. doi: 10.1038/nmeth.2171. Article   Pubmed

Additional References

  1. mScarlet: a bright monomeric red fluorescent protein for cellular imaging

    Bindels Ds, Haarbosch L, Van Weeren L, Postma M, Wiese Ke, Mastop M, Aumonier S, Gotthard G, Royant A, Hink Ma, Gadella Twj

    (2016). Nature Methods, 14(1) , 53-56. doi: 10.1038/nmeth.4074. Article   Pubmed

  2. Comparative assessment of fluorescent proteins for in vivo imaging in an animal model system

    Heppert Jk, Dickinson Dj, Pani Am, Higgins Cd, Steward A, Ahringer J, Kuhn Jr, Goldstein B

    (2016). Molecular Biology of the Cell, 27(22) , 3385-3394. doi: 10.1091/mbc.e16-01-0063. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change