compare

Comparison List

mApple

mApple is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Discosoma sp.. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 27.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
568 592 75,000 0.49 36.75 6.5 30.0 2.9

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
95.3 ± 1.7 (10000 cells) - HeLa Cranfill et al. (2016)
87.0 (103 cells) 2.2 ± 0.2 (14 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
4.8 Bindels et al. (2016)

mApple Sequence

mApple was derived from mOrange with the following mutations: R17H/G40A/T66M/A71V/V73I/K92R/V104I/V105I/T106H/T108N/E117V/S147E/G159S/M163K/T174A/S175A/G196D/T202V
amino acid numbers relative to DsRed. show relative to mOrange

MVSKGEENNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEAFQTAKLKVTKGGPLPFAWDILSPQFMYGSKVYIKHPADIPDYFKLSFPEGFRWERVMNFEDGGIIHVNQDSSLQDGVFIYKVKLRGTNFPSDGPVMQKKTMGWEASEERMYPEDGALKSEIKKRLKLKDGGHYAAEVKTTYKAKKPVQLPGAYIVDIKLDIVSHNEDYTIVEQYERAEGRHSTGGMDELYK
GenBank: ABC66097

Excerpts

Six generations of directed evolution [of mOrange] with constant photostability selection yielded the variant mApple, which, though substantially brighter than mCherry, displayed complex photoswitching behavior. This behavior was more pronounced with continuous wide-field than with laser-scanning illumination and could be largely eliminated by excitation at alternate wavelengths or by intermittent illumination. However, given our later results using the brighter TagRFP as starting material, we chose not to pursue mApple any further.

Shaner et al. (2008)

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change