compare

Comparison List

TagRFP-T

TagRFP-T is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.6 kDa -

FPbase ID: LF3LJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
555 584 81,000 0.41 33.21 4.6 100.0 2.3

TagRFP-T OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
41.2 ± 4.0 (10000 cells) - HeLa Cranfill et al. (2016)
43.0 (740 cells) - U-2 OS Manna et al. (2018)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
337.0   Bindels et al. (2016)

TagRFP-T Sequence

TagRFP-T was derived from TagRFP with the following mutations: S2_S2delinsVSKGE/S158T/H230_K231insKLNGMDELY

Note: While the only significant mutation in TagRFP-T relative to the parental TagRFP is S158T, here we show the version with the addition of the EGFP N- and C- termini that is by far the most variant (e.g. on Addgene and SnapGene)

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRTDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: ACD03281

Structure

Deposited: ,
Chromophore:

Excerpts

Negligible photochromic behavior was measured for the mScarlet variants, while TagRFP-T, mRuby2, mRuby3 and mApple showed 15%, 19%, 41%, and 51% photochromic behavior, respectively. Hence, extreme care must be taken when using the latter four RFP variants as acceptors in FRET studies, since a photochromic effect is easily confused with a changed FRET state, especially if one considers that the typical FRET contrast in many sensors is in the range of only 5–20%. The photochromic behavior can also interfere with characterization of FPs, like determination of photostability (Supplementary Fig. 8) or brightness (Supplementary Fig. 5l).

Bindels et al. (2016)

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change