mScarlet

mScarlet is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct. It has moderate acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	synthetic construct	26.4 kDa	-

FPbase ID: FVS3D

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
569	594	100,000	0.7	70.0	5.3	174.0	3.9

Edit States/Attributes

mScarlet OSER Measurements

% Normal Cells	OSER/NE ratio	Cell Type	Reference
80.0 (215 cells)	1.7 ± 0.3 (41 cells)	U-2 OS	Bindels et al. (2016)

Photostability

t_1/2 (s)	Power	Light	Mode	In Cell	Fusion	˚C	Reference
277.0	6.9 (W/cm2)	Arc-lamp	Widefield		H2A	37.0	Bindels et al. (2016)
161.0	1.35 (W/cm2)	Laser	Spinning Disc Confocal		H2A	37.0	Bindels et al. (2016)

A caution on interpretation of photostability measurements

Add photostability info

mScarlet Sequence

BLAST

mScarlet was derived from mRed7Q1S1BM with the following mutations: F84Y/V176A/E199KF84Y/V176A/E199K

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

GenBank: APD76535

IPG: 129830964

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

The fluorescence lifetime of mScarlet is 3.9 ns, the highest value recorded to date for mRFPs, and it shows monoexponential decay. The quantum yield of mScarlet is 0.70; much higher than the quantum yield of other monomeric RFPs. The extinction coefficient of mScarlet is 100,300 M−1 cm−1, resulting in the highest calculated brightness in the mRFP spectral class, with a >3.5-fold increase relative to mCherry. Brightness analysis in mammalian cells confirmed that mScarlet is an extremely bright mRFP , especially when compared with mRuby2, mRuby3 and TagRFP-T.

Bindels et al. (2016)