compare

Comparison List

mScarlet

mScarlet is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 594 100,000 0.7 70.0 5.3 174.0 3.9

mScarlet OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
80.0 (215 cells) 1.7 ± 0.3 (41 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
277.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)
161.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)

mScarlet Sequence

mScarlet was derived from mRed7Q1S1BM with the following mutations: F84Y/V176A/E199K

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76535
IPG: 129830964

Structure

Deposited: ,
Chromophore:

Excerpts

The fluorescence lifetime of mScarlet is 3.9 ns, the highest value recorded to date for mRFPs, and it shows monoexponential decay. The quantum yield of mScarlet is 0.70; much higher than the quantum yield of other monomeric RFPs. The extinction coefficient of mScarlet is 100,300 M−1 cm−1, resulting in the highest calculated brightness in the mRFP spectral class, with a >3.5-fold increase relative to mCherry. Brightness analysis in mammalian cells confirmed that mScarlet is an extremely bright mRFP , especially when compared with mRuby2, mRuby3 and TagRFP-T.

Bindels et al. (2016)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change