compare

Comparison List

mScarlet

mScarlet is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct. It is reported to be a very slowly-maturing monomer with moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 594 100,000 0.7 70.0 5.3 174.0 3.9

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
80.0 (215 cells) 1.7 ± 0.3 (41 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
277.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)
161.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)

mScarlet Sequence

mScarlet was derived from mRed7Q1S1BM with the following mutations: F84Y/V176A/E199K

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76535
IPG: 129830964

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mScarlet
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change