compare

Comparison List

TagRFP

TagRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2007, derived from Entacmaea quadricolor. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Entacmaea quadricolor 26.1 kDa -

FPbase ID: S4HC8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
555 584 100,000 0.48 48.0 3.8 100.0 2.3

TagRFP OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
57.7 ± 7.5 (10000 cells) - HeLa Cranfill et al. (2016)
- 3.9 ± 0.2 (67 cells) U-2 OS Costantini et al. (2012)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
48.0   Merzlyak et al. (2007)

TagRFP Sequence

TagRFP was derived from TurboRFP with the following mutations: K42R/K67R/A68T/I93V/F110L/N112D/I115L/N122R/R138L/R155E/H157R/Q159D/Y169H/H171I/S173N/F192V/H193Y/F194Y/M216V/K220R/R231K

Note: While the sequence below matches the sequence shown in Supp. Fig 1 of the original publication (Merzlyak et al, 2007), most commonly used variants (e.g. at Addgene and Snapgene) show TagRFP with N terminus from EGFP (MVSKGEE). Another literature inconsistency: Subach et al (2008), which derives mTagBFP from TagRFP, shows TagRFP with two glutamic acids in the N terminus instead of one.

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK
GenBank: ABR08320
IPG: 13144495

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for TagRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. ClearSeeAlpha: Advanced Optical Clearing for Whole-Plant Imaging

    Kurihara D, Mizuta Y, Nagahara S, Higashiyama T

    (2021). Plant and Cell Physiology, 62(8) , 1302-1310. doi: 10.1093/pcp/pcab033. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change