compare

Comparison List

mOrange

mOrange is a basic (constitutively fluorescent) orange fluorescent protein published in 2004, derived from Discosoma sp.. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: G6HDH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
548 562 71,000 0.69 48.99 6.5 150.0  

mOrange OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
91.4 ± 1.7 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
6.4   Shu et al. (2006)

mOrange Sequence

mOrange was derived from mOFP.T.8 with the following mutations: T41F/L83F/D174T/A175S/K194I/D196G
amino acid numbers relative to DsRed. show relative to mOFP.T.8

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
GenBank: AAV52165
IPG: 3838262

Structure

Deposited: ,
Chromophore (TYG):

Excerpts

No excerpts have been added for mOrange
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change