compare

Comparison List

mRed7Q1S1BM

mRed7Q1S1BM is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 86QDA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 596         3.3

Photostability

No photostability measurements available ... add one!

mRed7Q1S1BM Sequence

mRed7Q1S1BM was derived from mRed7Q1S1 with the following mutations: E7A/Q14R/V23M/A58S/Y73F/L86Q/S112T/F125L/P146A/Q154E/E161D/S163K/K167R/H173R/M183K/L190M/K199E/A218S

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYFKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLVDFKTTYKAKKPVQMPGAYNVDRELDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mRed7Q1S1BM
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change