compare

Comparison List

mMaple2

mMaple2 is a photoconvertible green fluorescent protein published in 2014, derived from Clavularia sp..
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Clavularia sp. 27.2 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 492 506          
Red 570 582          

Transitions

From To Switch λ
Green Red 405

Photostability

no photostability measurements available ... add one!

mMaple2 Sequence

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPEDIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPDAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK

Excerpts

No excerpts have been added for mMaple2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Characterization and development of photoactivatable fluorescent proteins for single-molecule-based superresolution imaging

Wang S, Moffitt Jr, Dempsey Gt, Xie Xs, Zhuang X

(2014). Proceedings of the National Academy of Sciences, 111(23) , 8452-8457. doi: 10.1073/pnas.1406593111. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change