compare

Comparison List

mMaple2

mMaple2 is a photoconvertible green fluorescent protein published in 2014, derived from Clavularia sp..
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Clavularia sp. 27.2 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 492 506          
Red 570 582          

Transitions

From To Switch λ
Green Red 405

Photostability

no photostability measurements available ... add one!

mMaple2 Sequence

mMaple2 was derived from mMaple with the following mutations: I144N/Y230A
amino acid numbers relative to cFP484. show relative to mMaple

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPEDIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPDAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK

Excerpts

... our results show that mMaple has a much higher signaling efficiency than Dendra2, mEos2, mEos3.2, tdEos, mKikGR, PAmCherry, and PATagRFP. However, the dimerization tendency of mMaple could lead to aggregation effects on the target proteins. Dendra2, mEos3.2, and PATagRFP exhibit undetectable dimerization tendency, but have low signaling efficiency. It is thus desirable to develop a new PAFP that has both high signaling efficiency and low dimerization tendency. To this end, we engineered two new PAFPs by introducing point mutations into mMaple designed to destabilize the dimerization of this protein.

Wang et al. (2014)

Primary Reference

Characterization and development of photoactivatable fluorescent proteins for single-molecule-based superresolution imaging

Wang S, Moffitt Jr, Dempsey Gt, Xie Xs, Zhuang X

(2014). Proceedings of the National Academy of Sciences, 111(23) , 8452-8457. doi: 10.1073/pnas.1406593111. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change