compare

Comparison List

mKikGR

a.k.a. monomeric Kikume Green-Red, mKikGR1

mKikGR is a photoconvertible green/yellow fluorescent protein published in 2008, derived from Favia favus. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Favia favus 26.6 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 580 591 28,000 0.63 17.64 5.2    
Green 505 515 49,000 0.69 33.81 6.6    

Transitions

From To Switch λ
Green Red 390

Photostability

no photostability measurements available ... add one!

mKikGR Sequence

MVSVITSEMKIELRMEGSVNGHKFVITGKGSGRPYEGTQTVDLTVIEGGPLPFAFDILTTAFHYGNRVFVEYPEEIVDYFKQSFPEGYSWERSMSYEDGGICLATNNITMKKDGSNTFVNEIRFDGTNFPANGPVMQRKTVKWEPSTEKMYVRDGVLKGDVEMALLLEGGGHYRCDFRTTYKAKKVVQLPDYHYVDHQMEITSHDKDYNKVKAYEHAKAYSGTYRGAKYEFEA

Excerpts

No excerpts have been added for mKikGR
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

mKikGR, a Monomeric Photoswitchable Fluorescent Protein

Habuchi S, Tsutsui H, Kochaniak Ab, Miyawaki A, Van Oijen Am

(2008). PLoS ONE, 3(12) , e3944. doi: 10.1371/journal.pone.0003944. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change