Change History for mMaple2

• 2018-10-06 13:08, user: talley
  • removed reference Wang et al. (2014)
  • added protein mMaple2 default_state_id: 548
  • added protein mMaple2 switch_type: o
  • added State mMaple2 (Red)
  • added State mMaple2 (Green)
• 2018-10-06 13:08, user: talley
  • added state transition Transition: mMaple2 Green -> Red
• 2018-10-06 13:10, user: talley
  • added protein mMaple2 agg: wd
  • changed protein mMaple2 switch_type: o->pc
• 2018-10-06 15:04, user: talley
  • changed protein mMaple2 default_state_id: 548->547
  • added protein mMaple2 seq: MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPEDIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPDAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK
• 2018-10-21 15:43, user: talley
  • added protein mMaple2 parent_organism_id: 86521
• 2018-12-16 02:41, user: talley
  • added protein mMaple2 references: Wang et al. (2014)
  • added excerpt Wang et al. (2014): ... our results show that mMap...
• 2018-12-16 02:41, user: talley
  • changed excerpt Wang et al. (2014): ... our results show that mMap... content: ... our results show that mMaple has a much higher signaling efficiency than Dendra2, mEos2, mEos3.2, tdEos, mKikGR, PAmCherry, and PAtagRFP. However, the dimerization tendency of mMaple could lead to aggregation effects on the target proteins. Dendra2, mEos3.2, and PAtagRFP exhibit undetectable dimerization tendency, but have low signaling efficiency. It is thus desirable to develop a new PAFP that has both high signaling efficiency and low dimerization tendency. To this end, we engineered two new PAFPs by introducing point mutations into mMaple designed to destabilize the dimerization of this protein.->... our results show that mMaple has a much higher signaling efficiency than Dendra2, mEos2, mEos3.2, tdEos, mKikGR, PAmCherry, and PATagRFP. However, the dimerization tendency of mMaple could lead to aggregation effects on the target proteins. Dendra2, mEos3.2, and PATagRFP exhibit undetectable dimerization tendency, but have low signaling efficiency. It is thus desirable to develop a new PAFP that has both high signaling efficiency and low dimerization tendency. To this end, we engineered two new PAFPs by introducing point mutations into mMaple designed to destabilize the dimerization of this protein.
• 2018-12-16 02:42, user: talley
  • added lineage mMaple2

Back to current mMaple2 version