compare

Comparison List

PAmCherry1

a.k.a. PA-mCherry, PAmCherry

PAmCherry1 is a photoactivatable red fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 564 595 18,000 0.46 8.28 6.3 23.0  
Off     6,500          

Transitions

From To Switch λ
Off On 405

Photostability

no photostability measurements available ... add one!

PAmCherry1 Sequence

PAmCherry1 was derived from mCherry with the following mutations: E26V/A57T/K70N/L83F/N98K/S146L/I161V/Q163P/L165V/I197R
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHVFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFTWDILSPQFMYGSNAYVKHPADIPDYFKLSFPEGFKWERVMKFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEALSERMYPEDGALKGEVKPRVKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for PAmCherry1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change