compare

Comparison List

PATagRFP

PATagRFP is a photoactivatable red fluorescent protein published in 2010, derived from Entacmaea quadricolor. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.2 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 562 595 66,000 0.38 25.08 5.3    
Off              

Transitions

From To Switch λ
Off On 405

Photostability

no photostability measurements available ... add one!

PATagRFP Sequence

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSSTFINHTQGIPDFFKQSWPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKKTLGWEPSTEKLKPADGGLEGRVDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDRRLEIIKEADKETYWEQHEVAVARYSDLPSKLGHK

Excerpts

No excerpts have been added for PATagRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change