compare

Comparison List

mMaple

mMaple is a photoconvertible green fluorescent protein published in 2012, derived from Clavularia sp.. It has high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.2 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 489 505 15,000 0.74 11.1 8.2    
Red 566 583 30,000 0.56 16.8 7.3    

Transitions

From To Switch λ
Green Red 380

Photostability

no photostability measurements available ... add one!

mMaple Sequence

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPEDIPDYFKQSFPEGYSWERSMTYEDGGICIATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPDYHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK

Excerpts

No excerpts have been added for mMaple
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change