compare

Comparison List

EGFP

a.k.a. enhanced GFP, GFPmut1

similar: mEGFP

EGFP is a basic (constitutively fluorescent) green fluorescent protein published in 1996, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 507 55,900 0.6 33.54 6.0 25.0 2.6

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
76.5 ± 6.9 (10000 cells) - HeLa Cranfill et al. (2016)
76.5 ± 6.9 (10000 cells) - HeLa Shaner et al. (2013)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
174.0 Arc-lamp Widefield none 23.0 Shaner et al. (2005)

EGFP Sequence

EGFP was derived from avGFP with the following mutations: M1_S2insV/F64L/S65T/H231L

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AAB02572
UniProtKB: C5MKY7
IPG: 928978

Structure

Deposited: ,
Chromophore (TYG):

Excerpts

No excerpts have been added for EGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

FACS-optimized mutants of the green fluorescent protein (GFP)

Cormack Bp, Valdivia Rh, Falkow S

(1996). Gene, 173(1) , 33-38. doi: 10.1016/0378-1119(95)00685-0. Article

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  2. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

  3. An Enhanced Green Fluorescent Protein Allows Sensitive Detection of Gene Transfer in Mammalian Cells

    Zhang G, Gurtu V, Kain Sr

    (1996). Biochemical and Biophysical Research Communications, 227(3) , 707-711. doi: 10.1006/bbrc.1996.1573. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change