compare

Comparison List

EGFP

a.k.a. enhanced GFP, GFPmut1

similar: mEGFP

EGFP is a basic (constitutively fluorescent) green fluorescent protein published in 1996, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

FPbase ID: R9NL8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 507 55,900 0.6 33.54 6.0 25.0 2.6

EGFP OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
76.5 ± 6.9 (10000 cells) - HeLa Hoi et al. (2013)
- 3.89 ± 0.25 (50 cells) U-2 OS Costantini et al. (2012)
76.5 ± 6.9 (10000 cells) - HeLa Cranfill et al. (2016)
76.5 ± 6.9 (10000 cells) - HeLa Shaner et al. (2013)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
174.0 Arc-lamp Widefield none 23.0 Shaner et al. (2005)
50.1 1.5 (mW) Laser Point Scanning Confocal Hela Zhong et al. (2018)

EGFP Sequence

EGFP was derived from avGFP with the following mutations: M1_S2insV/F64L/S65T/H231L

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AAB02572
UniProtKB: C5MKY7
IPG: 928978

Structure

Deposited: ,
Chromophore (TYG):

Excerpts

In EGFP, the direction of the transition dipole moment is 14° from the line connecting the centers of the aromatic rings.

Myšková et al. (2020)

Primary Reference

FACS-optimized mutants of the green fluorescent protein (GFP)

Cormack Bp, Valdivia Rh, Falkow S

(1996). Gene, 173(1) , 33-38. doi: 10.1016/0378-1119(95)00685-0. Article

Additional References

  1. Directionality of light absorption and emission in representative fluorescent proteins

    Myšková J, Rybakova O, Brynda J, Khoroshyy P, Bondar A, Lazar J

    (2020). Proceedings of the National Academy of Sciences, 117(51) , 32395-32401. doi: 10.1073/pnas.2017379117. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  3. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

  4. An Enhanced Green Fluorescent Protein Allows Sensitive Detection of Gene Transfer in Mammalian Cells

    Zhang G, Gurtu V, Kain Sr

    (1996). Biochemical and Biophysical Research Communications, 227(3) , 707-711. doi: 10.1006/bbrc.1996.1573. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change