compare

Comparison List

EGFP

a.k.a. enhanced GFP, GFPmut1

similar: mEGFP

EGFP is a basic (constitutively fluorescent) green fluorescent protein published in 1996, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

FPbase ID: R9NL8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 507 55,900 0.6 33.54 6.0 25.0 2.6

EGFP OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
76.5 ± 6.9 (10000 cells) - HeLa Hoi et al. (2013)
- 3.89 ± 0.25 (50 cells) U-2 OS Costantini et al. (2012)
76.5 ± 6.9 (10000 cells) - HeLa Cranfill et al. (2016)
76.5 ± 6.9 (10000 cells) - HeLa Shaner et al. (2013)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
50.1 1.5 (mW) Laser Point Scanning Confocal Hela Zhong et al. (2018)
174.0 Arc-lamp Widefield none 23.0 Shaner et al. (2005)

EGFP Sequence

EGFP was derived from avGFP with the following mutations: M1_S2insV/F64L/S65T/H231L

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AAB02572
UniProtKB: C5MKY7
IPG: 928978

Structure

Deposited: ,
Chromophore (TYG):

Excerpts

In EGFP, the direction of the transition dipole moment is 14° from the line connecting the centers of the aromatic rings.

Myšková et al. (2020)

Primary Reference

FACS-optimized mutants of the green fluorescent protein (GFP)

Cormack Bp, Valdivia Rh, Falkow S

(1996). Gene, 173(1) , 33-38. doi: 10.1016/0378-1119(95)00685-0. Article

Additional References

  1. Directionality of light absorption and emission in representative fluorescent proteins

    Myšková J, Rybakova O, Brynda J, Khoroshyy P, Bondar A, Lazar J

    (2020). Proceedings of the National Academy of Sciences, 117(51) , 32395-32401. doi: 10.1073/pnas.2017379117. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  3. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

  4. An Enhanced Green Fluorescent Protein Allows Sensitive Detection of Gene Transfer in Mammalian Cells

    Zhang G, Gurtu V, Kain Sr

    (1996). Biochemical and Biophysical Research Communications, 227(3) , 707-711. doi: 10.1006/bbrc.1996.1573. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change