compare

Comparison List

mEGFP

similar: EGFP

mEGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2002, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 507 56,000 0.6 33.6 6.0    

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
98.1 ± 1.6 (10000 cells) - HeLa Cranfill et al. (2016)
98.1 ± 1.6 (10000 cells) - HeLa Shaner et al. (2013)
97.0 ± 2.1 (10000 cells) - HeLa Paez-Segala et al. (2015)
96.8 ± 0.5 (150 cells) - - Bajar et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
46.0 240.0 (uW) Laser Point Scanning Confocal Cranfill et al. (2016)
239.0 60.0 (uW) Laser Point Scanning Confocal Cranfill et al. (2016)

mEGFP Sequence

mEGFP was derived from EGFP with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to EGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

We replaced hydrophobic residues at the crystallographic interface of the dimer with positively charged residues (A206K, L221K, or F223R). These mutants were likewise expressed and purified, and their self-association was measured by analytical ultracentrifugation... We call these novel monomeric GFP variants mCFP, mGFP, and mYFP. These mutations caused no significant alterations in the spectral properties.

Zacharias (2002)

Primary Reference

Partitioning of Lipid-Modified Monomeric GFPs into Membrane Microdomains of Live Cells

Zacharias Da

(2002). Science, 296(5569) , 913-916. doi: 10.1126/science.1068539. Article   Pubmed

Additional References

  1. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change