compare

Comparison List

StayGold

StayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Cytaeis uchidae. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Cytaeis uchidae 24.6 kDa -

FPbase ID: 71X7X

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 505 159,000 0.93 147.87 4.0    

Photostability

No photostability measurements available ... add one!

StayGold Sequence

MASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

Excerpts

The high photostability and brightness of StayGold allowed us to select moderately bright cells for observation with continuous illumination and to perform experiments in which imaging performance was not limited by photobleaching.

Hirano et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change