compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mStayGold

a.k.a. mSG, StayGold E138D

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Jul 3, 2023 21:37:01. Or view the full change history

mStayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae. It has low acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Cytaeis uchidae	24.6 kDa	-

FPbase ID: Q8WTP

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
497	504	145,000	0.87	126.15	4.6

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mStayGold Sequence

mStayGold was derived from StayGold with the following mutations: E138DE138D

MASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNDVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

Excerpts

No excerpts have been added for mStayGold
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A monomeric StayGold fluorescent protein

Crow A, Ivorra-Molla E, Akhuli D, Mcandrew M, Kumar L, Scott W, Mishima M, Palani S, Balasubramanian M

(2023). , , . doi: 10.21203/rs.3.rs-2684100/v1. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for mStayGold

Change history

Something missing or incorrect? Submit a change Submit a change