compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

StayGold

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Jan 17, 2023 14:14:06. Or view the full change history

StayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Cytaeis uchidae. It has low acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Dimer	Cytaeis uchidae	24.6 kDa	-

FPbase ID: 71X7X

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
496	505	159,000	0.93	147.87	4.0

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

StayGold Sequence

MASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

The high photostability and brightness of StayGold allowed us to select moderately bright cells for observation with continuous illumination and to perform experiments in which imaging performance was not limited by photobleaching.

Hirano et al. (2022)

Primary Reference

A highly photostable and bright green fluorescent protein

Hirano M, Ando R, Shimozono S, Sugiyama M, Takeda N, Kurokawa H, Deguchi R, Endo K, Haga K, Takai-Todaka R, Inaura S, Matsumura Y, Hama H, Okada Y, Fujiwara T, Morimoto T, Katayama K, Miyawaki A

(2022). Nature Biotechnology, , . doi: 10.1038/s41587-022-01278-2. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for StayGold

Change history

Something missing or incorrect? Submit a change Submit a change