compare

Comparison List

dfGFP

dfGFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2018, derived from Olindias formosus. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Olindias formosus 25.8 kDa -

FPbase ID: P2PV8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
505 524     3.8    

Photostability

No photostability measurements available ... add one!

dfGFP Sequence

MASGRALFQYPMTSKIELNGEINGKKFKVAGEGFTPNSGRFNMHAYCTTGDLPMSWVVIASPLQYGFHMFAHYPEDITHFFQECFPGSYTLDRTLRMEGDGTLTTHHEYSLKDGCVTSKTTLNASGFDPKGATMTKSFVEQLPNQVEIFAEGNGIRLLSHVPYLKKDGTIQIGYQDCIVKPVGGKKVTQPKYHFLHTQIIQKKDPNDTRDHIVQTELAVAGNPWHEPSASAV
GenBank: BBC28143

Excerpts

The tentacle sections from the flower hat jellyfish (Olindias formosa) that emit strong green fluorescence were investigated for unidentified GFP genes. In brief, an Escherichia coli cDNA expression library was constructed from jellyfish mRNA. Several green fluorescent colonies were isolated from a pool of ∼20,000 colonies, leading to the identification of a novel GFP, designated dfGFP, sharing little similarity to the known FPs.

Shinoda et al. (2018)

Primary Reference

Acid-Tolerant Monomeric GFP from Olindias formosa

Shinoda H, Ma Y, Nakashima R, Sakurai K, Matsuda T, Nagai T

(2018). Cell Chemical Biology, 25(3) , 330-338.e7. doi: 10.1016/j.chembiol.2017.12.005. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change