compare

Comparison List

RDSmCherry1

RDSmCherry1 is a basic (constitutively fluorescent) far red fluorescent protein published in 2017, derived from Discosoma sp.. It has moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
600 630 55,400 0.09 4.99 5.6    

Photostability

no photostability measurements available ... add one!

RDSmCherry1 Sequence

RDSmCherry1 was derived from RDSmCherry0.5 with the following mutations: Y197I
amino acid numbers relative to DsRed. show relative to RDSmCherry0.5

MVSKGEEDNMAIIKEFMRFKSHMEGSVNGHEFEIEGEGEGRPYEGTQTCKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEPSSERMYPEDGALKGEGKGRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNCNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

The bacterial cytotoxicity assay demonstrated that RDSmCherry1 has cytotoxicity similar to that of mCherry and LSSmCherry1, indicating that the decreased cytotoxicity of mCherry2 was lost during directed evolution.

Shen et al. (2017)

... We have used protein design and directed evolution to develop new RFP variants with low cytotoxicity to E. coli and altered fluorescence excitation and emission profiles. However, at this stage of development, none of these variants are improved relative to the current state of the art monomeric RFPs in their respective classes. ... mCardinal, which is derived from Entacmaea quadricolor eqFP578, is 3.3× brighter than RDSmCherry1 and has an emission peak that is 29 nm more red-shifted. So, while these new mCherry variants are unlikely to find immediate use in live cell imaging applications, they do provide insight into the influence of the protein structure on mCherry’s fluorescence and cytotoxicity properties and may serve as starting points for future probe development efforts.

Shen et al. (2017)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change