compare

Comparison List

RDSmCherry0.5

RDSmCherry0.5 is a basic (constitutively fluorescent) far red fluorescent protein published in 2017, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: CS45L

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
604 636 23,300 0.02 0.47      

Photostability

No photostability measurements available ... add one!

RDSmCherry0.5 Sequence

RDSmCherry0.5 was derived from RDSmCherry0.2 with the following mutations: V16S/A44C/A145P
amino acid numbers relative to DsRed. show relative to RDSmCherry0.2

MVSKGEEDNMAIIKEFMRFKSHMEGSVNGHEFEIEGEGEGRPYEGTQTCKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEPSSERMYPEDGALKGEGKGRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNCNYKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for RDSmCherry0.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change