compare

Comparison List

eqFP611

a.k.a. equaRFP

eqFP611 is a basic (constitutively fluorescent) red fluorescent protein published in 2002, derived from Entacmaea quadricolor. It has very low acid sensitivity.
+
eqFP611 Spectrum Fluorescent protein eqFP611 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.1 kDa -

FPbase ID: R5RQ5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
559 611 78,000 0.45 35.1 3.84 270.0 2.5

Photostability

No photostability measurements available ... add one!

eqFP611 Sequence

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL
GenBank: AAN05449
UniProtKB: Q8ISF8
IPG: 612407

Structure

Deposited: ,
Chromophore:

Excerpts

The protein has a reduced tendency to oligomerize, as shown by its monomeric appearance in SDS/PAGE analysis and single-molecule experiments. However, it forms tetramers at higher concentrations in the absence of detergent.

Wiedenmann et al. (2002)

Together, eqFP578 and eqFP611 represent a separate group of red fluorescent proteins, which are characterized by high fluorescence brightness, complete chromophore maturation and, notably, a reduced tendency to oligomerize. These features make E. quadricolor fluorescent proteins an attractive starting point for the generation of bright monomeric red fluorescent proteins.

Merzlyak et al. (2007)

The precursor to mRuby, eqFP611 dimer, readily undergoes reversible photobleaching due to isomerization from a bright trans form to a dim cis form, and mutations near the chromophore affect isomerization

Lam et al. (2012)

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change