compare

Comparison List

EBFP2

EBFP2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2007, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
EBFP2 Spectrum Fluorescent protein EBFP2 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: DVMQ7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
383 448 32,000 0.56 17.92 5.3 25.0 3.0

EBFP2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
36.3 (138 cells) - HeLa Costantini et al. (2015)
57.0 ± 2.7 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
55.0   Subach et al. (2008)

EBFP2 Sequence

EBFP2 was derived from EBFP1.2 with the following mutations: I128V/V150I/D155V/V224R
amino acid numbers relative to avGFP. show relative to EBFP1.2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNFNSHNIYIMAVKQKNGIKVNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSVLSKDPNEKRDHMVLLEFRTAAGITLGMDELYK
GenBank: ABP88743
IPG: 12966089

Excerpts

No excerpts have been added for EBFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change