compare

Comparison List

Comparing:

mScarlet, mScarlet-I, mCherry

You can share this comparison at: www.fpbase.org/compare/mscarlet,mscarlet-i,mcherry

Attribute Comparison

Name λex λem StokesλΔ EC QY Brightness pKa Aggregation Maturation Lifetimeτ kDa
mScarlet 569 594 25 100,000 0.7 70.0 5.3 m 174.0 3.9 26.35
mScarlet-I 569 593 24 104,000 0.54 56.16 5.4 m 36.0 3.1 26.36
mCherry 587 610 23 72,000 0.22 15.84 4.5 m 15.0 1.4 26.72

Sequence Comparison

mScarlet        MVSKGE----AVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP
mScarlet-I      MVSKGE----AVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP
mCherry         MVSKGEednmAiIKEFMRFKVHMEGSvNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP

mScarlet        FSWDILSPQFMYGSRAFtKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLED
mScarlet-I      FSWDILSPQFMYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLED
mCherry         FaWDILSPQFMYGSkAyVKHPADIPDYlKlSFPEGFKWERVMNFEDGGvVTVTQDsSLqD

mScarlet        GTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYlA
mScarlet-I      GTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYlA
mCherry         GefIYKVKLRGTNFPsDGPVMQKKTMGWEASsERmYPEDGaLKGeIKqrLkLKDGGhYdA

mScarlet        DFKTTYKAKKPVQMPGAYNVDrKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
mScarlet-I      DFKTTYKAKKPVQMPGAYNVDrKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
mCherry         evKTTYKAKKPVQlPGAYNVniKLDITSHNEDYTiVEQYERaEGRHSTGGMDELYK

References

  1. Shaner et al. (2004) Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein. Nature Biotechnology.Journal   Pubmed

  2. Shu et al. (2006) Novel Chromophores and Buried Charges Control Color in mFruits†,‡. Biochemistry.Journal   Pubmed

  3. Merzlyak et al. (2007) Bright monomeric red fluorescent protein with an extended fluorescence lifetime. Nature Methods.Journal   Pubmed

  4. Drobizhev et al. (2011) Two-photon absorption properties of fluorescent proteins. Nature Methods.Journal   Pubmed

  5. Landgraf et al. (2012) Segregation of molecules at cell division reveals native protein localization. Nature Methods.Journal   Pubmed

  6. Bindels et al. (2016) mScarlet: a bright monomeric red fluorescent protein for cellular imaging. Nature Methods.Journal   Pubmed

  7. Heppert et al. (2016) Comparative assessment of fluorescent proteins for in vivo imaging in an animal model system. Molecular Biology of the Cell.Journal   Pubmed

  8. Mastop et al. (2017) Characterization of a spectrally diverse set of fluorescent proteins as FRET acceptors for mTurquoise2. Scientific Reports.Journal   Pubmed

  9. Chertkova et al. (2017) Robust and Bright Genetically Encoded Fluorescent Markers for Highlighting Structures and Compartments in Mammalian Cells. .Journal

  10. Balleza et al. (2017) Systematic characterization of maturation time of fluorescent proteins in living cells. Nature Methods.Journal   Pubmed

  11. Dunsing et al. (2018) Optimal fluorescent protein tags for quantifying protein oligomerization in living cells. Scientific Reports.Journal   Pubmed

  12. Wang et al. (2018) Spying on protein interactions in living cells with reconstituted scarlet light. The Analyst.Journal

  13. McCullock et al. (2020) Comparing the performance of mScarlet-I, mRuby3, and mCherry as FRET acceptors for mNeonGreen. PLOS ONE.Journal   Pubmed

  14. Myšková et al. (2020) Directionality of light absorption and emission in representative fluorescent proteins. Proceedings of the National Academy of Sciences.Journal   Pubmed