compare

Comparison List

mScarlet-I

mScarlet-I is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 593 104,000 0.54 56.16 5.4 36.0 3.1

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
76.0 (199 cells) 1.4 ± 0.2 (23 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
225.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)
190.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)

mScarlet-I Sequence

mScarlet-I was derived from mScarlet with the following mutations: T74I

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76536
IPG: 129830965

Excerpts

No excerpts have been added for mScarlet-I
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change