compare

Comparison List

mScarlet-I

mScarlet-I is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 593 104,000 0.54 56.16 5.4 36.0 3.1

mScarlet-I OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
76.0 (199 cells) 1.4 ± 0.2 (23 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
225.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)
190.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)

mScarlet-I Sequence

mScarlet-I was derived from mScarlet with the following mutations: T74I

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76536
IPG: 129830965

Excerpts

The single amino acid substitution T74I found in mScarlet-I results in a marked maturation acceleration in cells, but at the cost of a moderate decrease in fluorescence quantum yield (0.54) and fluorescence lifetime (3.1 ns), although both values are still higher than those of all previously engineered bright mRFPs.

Bindels et al. (2016)

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change