compare

Comparison List

mGreenLantern

a.k.a. mGL

mGreenLantern is a basic (constitutively fluorescent) green fluorescent protein published in 2020, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: G1VL1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
503 514 101,800 0.72 73.3 5.6 13.5  

Photostability

No photostability measurements available ... add one!

mGreenLantern Sequence

mGreenLantern was derived from Clover with the following mutations: F64L/S72A/E124V/N149K/I167T/S175G/A206K/L221K/F223R/G232D
amino acid numbers relative to avGFP. show relative to Clover

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLGYGVACFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNFNSHKVYITADKQKNGIKANFKTRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLKERVTAAGITHDMDELYK

Excerpts

mGreenLantern was 190% brighter than mNeonGreen, 260% brighter than Clover, and 620% brighter than EGFP when expressed in HeLa cells and showed faster and complete maturation. The brightness of mGreenLantern was superior regardless of mammalian cell line chosen, the specific organism or induction system, or the imaging and analysis method used... HEK293T human embryonic kidney cells, BE(2)-M17 human neuroblastoma cells, and E. coli all produced at least three times more mGreenLantern soluble protein than EGFP, mClover3, or mNeonGreen.

Campbell et al. (2020)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change