compare

Comparison List

mClover3

mClover3 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2016, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: RYFE4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
506 518 109,000 0.78 85.02 6.5 43.5 3.11

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
80.0   Bajar et al. (2016)

mClover3 Sequence

mClover3 was derived from dClover2 with the following mutations: S160C/A206K
amino acid numbers relative to avGFP. show relative to dClover2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTFGYGVACFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNCIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for mClover3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change