compare

Comparison List

mEosFP-M159A

mEosFP-M159A is a basic (constitutively fluorescent) green fluorescent protein published in 2011, derived from Lobophyllia hemprichii. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
487 514 98,600 0.52 51.27 4.3   3.2

Photostability

no photostability measurements available ... add one!

mEosFP-M159A Sequence

mEosFP-M159A was derived from mEosFP with the following mutations: A69V/M159A/F191L

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFVEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHAALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

In mEosFP, the main role of Met159 is to stabilize the neutral state of the chromophore and the M159A mutation cancels this stabilization. On the other hand, the anionic form may take advantage of the mutation by reorganizing and optimizing the hydrogen bond network surrounding the hydroxylate group of the chromophore. As a consequence, the M159A mutation disfavors photoconversion by lowering the fraction of neutral forms in the sample. An opposite effect has been observed in the structural comparison between EosFP and Dendra2, where an electrostatic interaction in EosFP is disrupted in Dendra2. This disruption decreases the stability of the anionic chromophore, resulting in a larger fraction of the neutral form and thus promoting photoconversion (Adam et al., 2009).

Adam et al. (2011)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change