compare

Comparison List

EosFP

a.k.a. lhemRFP

similar: mEosFP

EosFP is a photoconvertible green/yellow fluorescent protein published in 2004, derived from Lobophyllia hemprichii.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: 16WGJ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 506 516 72,000 0.7 50.4      
Red 571 581 41,000 0.55 22.55      

Transitions

From To Switch λ
Green Red 390

Photostability

No photostability measurements available ... add one!

EosFP Sequence

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR
GenBank: AAV54099
UniProtKB: Q5S6Z9
IPG: 3862138

Excerpts

No excerpts have been added for EosFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

EosFP, a fluorescent marker protein with UV-inducible green-to-red fluorescence conversion

Wiedenmann J, Ivanchenko S, Oswald F, Schmitt F, Rocker C, Salih A, Spindler K-D, Nienhaus Gu

(2004). Proceedings of the National Academy of Sciences, 101(45) , 15905-15910. doi: 10.1073/pnas.0403668101. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change