compare

Comparison List

mEosFP

a.k.a. mEos

similar: EosFP

mEosFP is a photoconvertible red fluorescent protein published in 2004, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: N8HMF

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 505 516 67,200 0.64 43.01 5.3   3.5
Red 569 581 37,000 0.62 22.94 6.5   4.1
Edit States/Attributes

Transitions

From To Switch λ
Green Red 400
Edit state transitions

Photostability

No photostability measurements available ... add one!

mEosFP Sequence

BLAST

mEosFP was derived from EosFP with the following mutations: V123T/T158H

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mEosFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

EosFP, a fluorescent marker protein with UV-inducible green-to-red fluorescence conversion

Wiedenmann J, Ivanchenko S, Oswald F, Schmitt F, Rocker C, Salih A, Spindler K-D, Nienhaus Gu

(2004). Proceedings of the National Academy of Sciences, 101(45) , 15905-15910. doi: 10.1073/pnas.0403668101. Article   Pubmed

Additional References

  1. Rational Design of Photoconvertible and Biphotochromic Fluorescent Proteins for Advanced Microscopy Applications

    Adam V, Moeyaert B, David Cc, Mizuno H, Lelimousin M, Dedecker P, Ando R, Miyawaki A, Michiels J, Engelborghs Y, Hofkens J

    (2011). Chemistry & Biology, 18(10) , 1241-1251. doi: 10.1016/j.chembiol.2011.08.007. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change