compare

Comparison List

FusionRed

FusionRed is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

FPbase ID: S6A7A

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
580 608 94,500 0.19 17.95 4.6 130.0 1.8

FusionRed OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
91.5 ± 3.0 (10000 cells) - HeLa Cranfill et al. (2016)
97.3 (148 cells) - HeLa Costantini et al. (2015)
86.0 (1220 cells) - U-2 OS Manna et al. (2018)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
150.0   Shemiakina et al. (2012)

FusionRed Sequence

FusionRed was derived from mKate2.5 with the following mutations: H10P/K67R/N71K/Q74P/I121V/L147M/K185T/R197H/N207D
amino acid numbers relative to eqFP578. show relative to mKate2.5

MVSELIKENMPMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPANGPVMQKKTLGWEASTETMYPADGGLEGACDMALKLVGGGHLICNLETTYRSKKPATNLKMPGVYNVDHRLERIKEADDETYVEQHEVAVARYSTGGAGDGGK

Excerpts

No excerpts have been added for FusionRed
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change