compare

Comparison List

mKate2.5

mKate2.5 is a monomeric fluorescent protein published in 2012, derived from Entacmaea quadricolor. It was an intermediate protein in the evolution of FusionRed from mKate2, and has significantly reduced maturation rate, fluorescence brightness and pH stability relative to mKate2.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

mKate2.5 Sequence

mKate2.5 was derived from mKate2 with the following mutations: A45V/T73P/S128A/R157A/A158C/K175E/Y194N/K207N/C222_R232delinsSTGGAGDGGK
amino acid numbers relative to eqFP578. show relative to mKate2

MVSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHPQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPANGPVMQKKTLGWEASTETLYPADGGLEGACDMALKLVGGGHLICNLETTYRSKKPAKNLKMPGVYNVDRRLERIKEADNETYVEQHEVAVARYSTGGAGDGGK

Excerpts

mKate2.5 is characterized by monomeric behavior at 10 mg ml−1 concentrations on HPLC... Maturation rate, fluorescence brightness and pH stability of mKate2.5 were significantly reduced compared with mKate2 (data not shown).

Shemiakina et al. (2012)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change