compare

Comparison List

mKate2.5

mKate2.5 is a monomeric fluorescent protein published in 2012, derived from Entacmaea quadricolor. It was an intermediate protein in the evolution of FusionRed from mKate2, and has significantly reduced maturation rate, fluorescence brightness and pH stability relative to mKate2.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

FPbase ID: LJPJE

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mKate2.5 Sequence

BLAST

mKate2.5 was derived from mKate2 with the following mutations: A45V/T73P/S128A/R157A/A158C/K175E/Y194N/K207N/C222_R231delinsSTGGAGDGGK
amino acid numbers relative to eqFP578. show relative to mKate2

MVSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHPQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPANGPVMQKKTLGWEASTETLYPADGGLEGACDMALKLVGGGHLICNLETTYRSKKPAKNLKMPGVYNVDRRLERIKEADNETYVEQHEVAVARYSTGGAGDGGK

Excerpts

mKate2.5 is characterized by monomeric behavior at 10 mg ml−1 concentrations on HPLC... Maturation rate, fluorescence brightness and pH stability of mKate2.5 were significantly reduced compared with mKate2 (data not shown).

Shemiakina et al. (2012)

Primary Reference

A monomeric red fluorescent protein with low cytotoxicity

Shemiakina Ii, Ermakova Gv, Cranfill Pj, Baird Ma, Evans Ra, Souslova Ea, Staroverov Db, Gorokhovatsky Ay, Putintseva Ev, Gorodnicheva Tv, Chepurnykh Tv, Strukova L, Lukyanov S, Zaraisky Ag, Davidson Mw, Chudakov Dm, Shcherbo D

(2012). Nature Communications, 3(1) , 1204. doi: 10.1038/ncomms2208. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change