compare

Comparison List

Electra2

Electra2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2022, derived from Entacmaea quadricolor.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 5GJX3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
403 456          

Photostability

No photostability measurements available ... add one!

Electra2 Sequence

Electra2 was derived from mRuby3 with the following mutations: K6E/M63L/Y64F/R67K/K81E/E114G/P127H/N129K/K138E/N143F/C172A/F174I/H197Y/Q213L/Y231aF
amino acid numbers relative to eqFP611. show relative to mRuby3

MVSKGEELIEENMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFLFGSKTFIKYPADIPDFFEQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGGLVYNVKVRGVNFHSKGPVMQKKTEGWEPFTEMMYPADGGLRGYTDIALKVDGGGHLHANIVTTYRSKKTVGNIKMPGVHAVDYRLERIEESDNETYVVLREVAVAKYSNLGGGMDELFK
GenBank: OL631607

Excerpts

Quantification of intracellular brightness revealed that Electra1 and Electra2 were 2.3- and 2.1-fold brighter than mTagBFP2

Papadaki et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change