compare

Comparison List

mTagBFP2

mTagBFP2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2011, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing monomer with very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.7 kDa -

FPbase ID: ZO7NN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 454 50,600 0.64 32.38 2.7 12.0 2.6

mTagBFP2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
49.8 ± 1.9 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1150.0 4.25 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)
996.0 0.91 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)
135.0 3.72 (mW/mm2) LED Widefield Primary hippocampal mouse neurons 21.0 Papadaki et al. (2022)

mTagBFP2 Sequence

mTagBFP2 was derived from TagBFP with the following mutations: S2_S2delinsVSKGE/I174A

MVSKGEELIKENMHMKLYMEGTVDNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFLYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEAFTETLYPADGGLEGRNDMALKLVGGSHLIANAKTTYRSKKPAKNLKMPGVYYVDYRLERIKEANNETYVEQHEVAVARYCDLPSKLGHKLN

Excerpts

No excerpts have been added for mTagBFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change