compare

Comparison List

mBlueberry2

mBlueberry2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2007, derived from Discosoma. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma 26.8 kDa -

FPbase ID: NYYN4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
402 467 51,000 0.48 24.48 2.5    

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
710.0 4.25 (mW/mm2) LED Widefield HEKT293T 21.0 Papadaki et al. (2022)
25.0 0.91 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)

mBlueberry2 Sequence

MVSKGEENNVAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFLFGSKVYIKHPADIPDYFKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGVFIYKVKLRGTNFPSDGPVMQKKTMGWEAFSERMYPEDGALKSEIKTRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDIVSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mBlueberry2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change