compare

Comparison List

Electra2

Electra2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2022, derived from Entacmaea quadricolor.
+
Electra2 Spectrum Fluorescent protein Electra2 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 5GJX3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
403 454 80,900 0.76 61.48     3.4

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
610.0 4.25 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)
1466.0 0.91 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)
200.0 3.72 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)

Electra2 Sequence

Electra2 was derived from mRuby3 with the following mutations: K6E/M63L/Y64F/R67K/K81E/E114G/P127H/N129K/K138E/N143F/C172A/F174I/H197Y/Q213L/Y231aF
amino acid numbers relative to eqFP611. show relative to mRuby3

MVSKGEELIEENMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFLFGSKTFIKYPADIPDFFEQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGGLVYNVKVRGVNFHSKGPVMQKKTEGWEPFTEMMYPADGGLRGYTDIALKVDGGGHLHANIVTTYRSKKTVGNIKMPGVHAVDYRLERIEESDNETYVVLREVAVAKYSNLGGGMDELFK
GenBank: OL631607

Excerpts

When transiently expressed in HEK cells, Electras were more than fourfold brighter than mBlueberry2 and about 1.4-fold brighter than EBFP2, while slightly dimmer than mTagBFP2 (Fig. 3a, Table 1).

Papadaki et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change