compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Electra1

You are viewing an older revision of this protein, from Jun 25, 2022 15:58:35. Click here to view the current version.

Electra1 is a basic (constitutively fluorescent) blue fluorescent protein published in 2022, derived from Entacmaea quadricolor.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Entacmaea quadricolor	26.4 kDa	-

FPbase ID: 5X9A8

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
402	456

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Electra1 Sequence

BLAST

Electra1 was derived from mRuby3 with the following mutations: K10E/M67L/Y68F/R71K/E118G/K142E/N147F/D155N/G171D/C176A/F178I/N190D/H201Y/I206V/Q217L K6E/M63L/Y64F/R67K/E114G/K138E/N143F/D151N/G167D/C172A/F174I/N186D/H197Y/I202V/Q213L
amino acid numbers relative to mRuby3 eqFP611. show relative to eqFP611 show relative to mRuby3

MVSKGEELIEENMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFLFGSKTFIKYPADIPDFFKQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGGLVYNVKVRGVNFPSNGPVMQKKTEGWEPFTEMMYPANGGLRGYTDIALKVDGDGHLHANIVTTYRSKKTVGDIKMPGVHAVDYRLERVEESDNETYVVLREVAVAKYSNLGGGMDELYK

GenBank: OL631606

Excerpts

Quantification of intracellular brightness revealed that Electra1 and Electra2 were 2.3- and 2.1-fold brighter than mTagBFP2

Papadaki et al. (2022)

Primary Reference

Dual-expression system for blue fluorescent protein optimization

Papadaki S, Wang X, Wang Y, Zhang H, Jia S, Liu S, Yang M, Zhang D, Jia J-M, Köster Rw, Namikawa K, Piatkevich Kd

(2022). Scientific Reports, 12(1) , 10190. doi: 10.1038/s41598-022-13214-0. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Electra1
Search RIKEN BRC for Electra1

Change history

Something missing or incorrect? Submit a change Submit a change